SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021546 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021546
Domain Number 1 Region: 18-46,89-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-21
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 194-295
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-18
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021546   Gene: ENSOGAG00000006619   Transcript: ENSOGAT00000006621
Sequence length 408
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:16123429:16230335:1 gene:ENSOGAG00000006619 transcript:ENSOGAT00000006621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSCSWGLGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQARQRWEERLANF
SRGHNLSRDELRGFLRHYEEASRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
VGGKIFLIFYGLVGCSSTILFFNLFLERLITVIAYIMKSCHQRQLRRRGALPPDSLKGAG
KCEVDSLAGWKPSVYYVMLILCTASVLISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF
GDLVSSQNAHYERQGLYRFANFVFILMGVCCIYSLFNVISILIKQSVNWILRKMDGGCCP
RCGRRVLRSRRNAVMPGTVRTRCDVSIETDAVAESEADARRLSGEMISVKDFLAANKVSL
AILQKQLSETANGCPHQTSALTRDDEFSGGVGAFAIMNNRLAETSGDR
Download sequence
Identical sequences H0XZK3
ENSOGAP00000021546 ENSOGAP00000021546 XP_003787029.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]