SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021975 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021975
Domain Number 1 Region: 200-377
Classification Level Classification E-value
Superfamily MIR domain 5.75e-47
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1064-1191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-18
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 644-779
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000259
Family SPRY domain 0.064
Further Details:      
 
Domain Number 4 Region: 423-535
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000589
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 86-170
Classification Level Classification E-value
Superfamily MIR domain 0.00000759
Family MIR domain 0.028
Further Details:      
 
Domain Number 6 Region: 4036-4114
Classification Level Classification E-value
Superfamily EF-hand 0.0000105
Family Calmodulin-like 0.041
Further Details:      
 
Domain Number 7 Region: 2179-2249
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000131
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000021975
Domain Number - Region: 1417-1539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000609
Family SPRY domain 0.036
Further Details:      
 
Domain Number - Region: 2582-2634,2666-2700,2939-3038,3118-3206,3663-3673,3850-4062
Classification Level Classification E-value
Superfamily ARM repeat 0.00123
Family HEAT repeat 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021975   Gene: ENSOGAG00000028400   Transcript: ENSOGAT00000029811
Sequence length 5022
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:7510198:7631626:1 gene:ENSOGAG00000028400 transcript:ENSOGAT00000029811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFVLEQSLSVR
ALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVG
LQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLHLSTASGELQVDASFM
QTLWNMNPICSRCEEGYVTGGHVLRLFHGHMDECLTISPADSDDQRRLVFYEGGAVCTHA
RSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLVVVDASKAHTKATSFCF
RISKEKLDTAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAAPDPKALRLGVLKKKA
MLHQEGHMDDALSLTRCQQEESQAARMIYSNAGLYNQFIKGLDSFSGKPRGSGPPAGTAL
PIEGVILSLQDLIVYFEPPSEELQHEEKQSKLRSLRNRQSLFQEEGMLSLVLNCIDRLNV
YTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFSTNLDWLVSKLDRLEA
SSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRS
NQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYNKWYFEVMVDEVVPFLT
AQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH
LLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVVSFSAGVKVRFLLGGR
HGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPV
DTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEP
ERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVR
LTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNR
DSLCQAVRTLLGYGYNIEPPDQEPSQVESQSRWDRVRIFRAEKSYAVQSGRWYFEFEAVT
TGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLT
ENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAI
CGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARMDGTVDTPPCLRLTHRT
WGSQNSLVEMIFLRLSLPVQFHQHFRCTAGATPLASPGLQPPAEDEARAAEPDPDYENLR
RSAGGWGETEGGKEGTAKEGVPGGTPQAGAEAQPARVENEKDATTEKNKKRGFLFKAKKV
AMMTQPPATPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRVFAGQEPSCVWVGWVTPD
YHQHDMNFDLSKVRAVTVTMGDEHGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHSDLVI
GCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAAFVLPTNQNVIQFELGKQKNIMPLS
AAMFLSERKNSAPQCPPRLEMQMLMPVSWSRMPNRFLQVETRRAGERLGWAVQCQEPLTM
MALHIPEENRCMDILELSERLQLQRFHSHTLRLYRAVCALGNNRVAHALCSHVDQAQLLH
ALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTEETRTITLFPSGRSTEN
GPCHHGLPGVGITTSLRPPHHFSPPCFVAALQAAGVAEAPVRLSPAIPLEALRDKALRML
GEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKLIEPEVFTEEE
EEEEEEEEEEDEEEKEADEEEEAQEKEDEEKEEEEEAEGEKEEGLEEGLLQMKLPESVKL
QMCHLLEYFCDQELQHRVESLAAFAERYVDKLQENQRSRYGLLMKAFTMSAAETARRTRE
FRSPPQEQINMLLHFKDPSNEEDCPLSEELRQDLLDFHQDLLAHCGIQLEGEEEEPEEET
TLGSRLMSLLEKVRLVKKKEEGPEEEPPAEESKPRSLQELVSHTVVRWAQEDFVQSPELV
RAMFSLLHRQYDGLGELLRALPRAYTISPSSMEDTMSLLECLGQIRSLLIVQMGPQEENL
MIQSIGNIMNNKVFYQHPNLMRALGMHETVMQVMVNVLGGGESKEIRFPKMVTSCCRFLC
YFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEK
VVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLL
IRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRREHFGEEPPEENRVH
LGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLEDLVGIISLPLQIP
TLGKDGALVQPKMSASFVPDHKGSMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLD
TATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTK
AQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCL
PTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAMPCLCAIAGALPPDYVDA
SYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSY
GENVDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEEKTEKK
KTRKISQSAQTYDAREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTWGRKKKQELEAK
GGGTHPLLVPYDTLTAKEKARDREKAQELMKFLQMNGYAVTRGLKDMELDSSSIEKRFAF
GFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTNHCLYF
LSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDA
RTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALL
PVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKNAYVEKLRPALGECLARL
AAAMPVAFLEPQLNEFNACSVYTTKSPRERAILGLPNSVEEMCPDIPVLERLMADIGGLA
ESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPTAGAPPPCTAVTSDHLNSLLGNI
LRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGRLRKRAAKVVAEEEQL
RLEAKAEAQEGEMLVRDEFSVLCRDLYALYPLLIRYVDNNRAQWLTEPNPNAEELFRMVG
EIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQERTKKKRR
GDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEVREFLQNNLHL
QGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYHLDQTEHPYKSKKAV
WHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMLLESYKATWILTEDHSFEDRMIDDLSK
AGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGG
ENAEEGEEEEAEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACKGETGAMVSSTL
KLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGM
VNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIIC
TVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQ
SLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNG
MIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMD
SQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDP
RLRNFLELAESILEYFRPYLGRIEIMGSSRRIERIYFEISETNRAQWEMPQVKESKRQFI
FDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPETEEDEGASAGEAGTEGAEE
GAEGPEGAASATAAAPGVTARAAAAAGRALSGLSYRSLRRRIRRLRRLTAREAATAAAAL
LWAAVTRVGAAGVGAAAGALRLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTGDEVHGEQ
PAGPGGETDGEGAGEGAGDTTEGADQEEAVAHEAGPGGADGVVAVSEGGPFRPEGAGGLG
DMGDTTPAEPPTPEGSPILKRKLGVDGEEELLPEPEPQPEPEPEPEKADAENGEKEEVPE
PPPEPPKKKAPPPAPPKKEEAWSEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINF
ILLFYKVSDSPPGEDDMEGSATGDLSGAGAGGGSGWGSGAGEEAEGEEDENMVYYFLEES
TGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDD
DVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAELLGMDLASLEITAHNE
RKPSPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLTWYMVMSLLGHYNNFFFAAHLLD
IAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMK
CDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGL
IIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYL
INKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences H0Y0T2
ENSOGAP00000021975 ENSOGAP00000021975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]