SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022013 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022013
Domain Number 1 Region: 214-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-39
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 73-142
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000242
Family RING finger domain, C3HC4 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022013   Gene: ENSOGAG00000028655   Transcript: ENSOGAT00000029701
Sequence length 413
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:249542:254434:-1 gene:ENSOGAG00000028655 transcript:ENSOGAT00000029701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRLWWRKRQSQERGRKAAKLNEGDAERGTDSASSQAGPPSARSKAVAVVAEGEASRPRL
LMDAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGTPPTTGAEAS
ATACPCCGLPCPRRCLRSNVRLAVEVRISRGLREKLAEPGARAGRRRGGRIPTMGCLDPH
AEDIRKTWRRFDVPTPKSSNSEDGLPEDYPVVKNMLHRLTADLTLDPGTAHRHLLISADC
RSVRVAPPGTPTPPDGPTRFDQLPAVLGAQGFGAGRHCWEVETTDTTCCTDSSGEDEDDG
ESRYAVGAAGESVQRKGRVKLCPAGAVWAVEGRGGRLWALTAPEPTLLGGARPPPRRIRV
DLDWERGRVAFYDGRSLDLLFAFQAPGPLGERIFPLFCTRDPRAPLRIVPAEG
Download sequence
Identical sequences H0Y0X0
ENSOGAP00000022013 ENSOGAP00000022013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]