SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022042 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022042
Domain Number 1 Region: 587-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000403
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 624-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000167
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000837
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000713
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022042   Gene: ENSOGAG00000031927   Transcript: ENSOGAT00000032405
Sequence length 720
Comment pep:known_by_projection scaffold:OtoGar3:GL873651.1:1634415:1641948:-1 gene:ENSOGAG00000031927 transcript:ENSOGAT00000032405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGTARAPAASVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAIPPSAPQVR
MVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCALSGGGGGAF
LHQEHAARQGAASAADGLGVSPKPSAPDFATAAQTGALRPHPQGLPPTQACGARDNIKRE
VSSAPLATSPPPGKWGPTKKGREQLDRALDRSGAARGHSHFLGIMGGSPAGGGGLAFYPG
VRSAFKPAGLARATVAAHADSYREENGGKHGAGLALGRLLGGGRAGGRPGSGENPVAGGA
GHHHHHHAHHHHHHPKCLLAGDPPPPPPSGLTCSGALRSFPLLPVPPEEASPFKHVERVP
PAAAAAAALPGARYTQLPAAPGLPLERCALPPLDPGGFKAFPGGECSHLPAVMPAFTVYN
GELLYGSPAAAAYYPFKLHFGGLLKYPESISYFGGPAAAALSPAELGSLASIDREIAMHT
QQLSEMAAGKGRGRLDSGTLPPAVVAAGGPGGSGSGGSGAGKPKTGHLCLYCGKLYSRKY
GLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLE
RHVKSRHPGQSLLAKAGEGPGAEPSYPPEPGDPKSEDSDVDVCFTDDQSDLEAGGGGERD
Download sequence
Identical sequences H0Y0Z9
ENSOGAP00000022042 ENSOGAP00000022042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]