SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022601 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022601
Domain Number 1 Region: 27-248
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.7e-61
Family Proteasome subunits 0.000000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022601   Gene: ENSOGAG00000034070   Transcript: ENSOGAT00000029520
Sequence length 300
Comment pep:known_by_projection scaffold:OtoGar3:GL873744.1:708208:709110:1 gene:ENSOGAG00000034070 transcript:ENSOGAT00000029520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQDVCKWQVPDTQRLSPHLPQSAGWAMPRGCDPQAFLQMRGPRLAHGTTTLAFRFQHG
VIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRALREG
QLPSVASAAKLLSAMMSRYRGLDLCVATALCGWDCSGPALFYVYSDGTRLQGDIFSVGSG
SPYAYGVLDRGYRYDMTTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRND
ACVLYKELQELREPALEEEACQAHPEPATTHISGEDGELSAGAREVTPGDSKMPAGTEVL
Download sequence
Identical sequences H0Y2K8
ENSOGAP00000022601 XP_003801968.1.62490 ENSOGAP00000022601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]