SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD000453 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD000453
Domain Number 1 Region: 28-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.13e-33
Family Thioltransferase 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD000453
Sequence length 167
Comment 167
Sequence
MEVYNSTPKVEFCLEEVVVLKMDVDMKEKNRCLEVVSWVDDKMERSDEEDKIDFKGGNVH
VISNKENWDHKIAEADKDGKIVIANFSAAWCGPCRVIAPVYAEMSQTYPQFMFLTIDVDE
LMDFSSSWDIRATPTFFFLKNGEQVDKLVGANKPELEKKVAALADSA
Download sequence
Identical sequences B8ADG2
39946.BGIOSIBCE000530 OsIBCD000453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]