SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD000500 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD000500
Domain Number 1 Region: 119-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.02e-26
Family Thioltransferase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD000500
Sequence length 243
Comment 243
Sequence
MVEHVYHFQQKWCVKTGNVHLAGSHGEVGVDRPHERAREIEPRAASSYFVLVFVSTPDLS
DENTVSRAVSQPAIQQFRNYSSGLGGDSSAKGDSSSTRVAADPDTHQDFQPTSKSSNMSF
DDIVARDIKENPVLIYMKGFPESPMCGFSALAIKVLKLYDVPISARDILGDLKLKECVKA
HTNWPTFPQIFIKGEFVGGSDIILDMHQASELIVPRFYYQKGQLKDVLGDISQKHEQKES
SCR
Download sequence
Identical sequences OsIBCD000500 39946.BGIOSIBCE000578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]