SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD000639 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD000639
Domain Number 1 Region: 49-249
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-59
Family BC ATP-binding domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 337-492
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 3.01e-56
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000183
Further Details:      
 
Domain Number 3 Region: 255-325
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000228
Family BC C-terminal domain-like 0.003
Further Details:      
 
Weak hits

Sequence:  OsIBCD000639
Domain Number - Region: 10-44
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.000259
Family BC N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD000639
Sequence length 499
Comment 499
Sequence
MSSGASMMAPRCGVLTVEIEHVDAVTLEKLEKQGIDCEPKASTIMIIQDKYRQKTHFSKF
GIPLPDFVEVDTLSSIEKAGEMFGYPLMVKSKRLAYDGRGNAVAHDKKELSSVVASLGGF
EHGLYVERWTSFVKELSVIVARSRDGSTVCYPVVETIHKDNICHVVEAPAEVPDKIKKLA
TNVAEKAIKSLEGAGVFAVELFLTQDNQVLLNEVAPRPHNSGHHTIESCYTSQYEQHLRA
ILGLPLGDPSMKAPASIMYNILGEDEGEAGFTQAHQLIERALDISGASVHWYAKPEIRKQ
RKMGHITIVGPSKYSVKARLDKLLQRDAYDPKKVKPRAAIIMGSDSDLPVMKDAAVVLKK
FNIPFELTIVSAHRTPERMYHYALSAKERGLEVIIAGMVASLTSVPVIGVPIMTSSLHGT
DSLLSIVQMPKGIPVATVAIGNAENAGLLAVRMLASRDPELGDKATEYQHDLRDMVLEKA
KRLEELGWEGYTELYLKKH
Download sequence
Identical sequences B8A6J6
OsIBCD000639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]