SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD000846 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD000846
Domain Number - Region: 392-437
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD000846
Sequence length 442
Comment 442
Sequence
MEQCHHHQQHSNGQQLQRLEGIEEEGGAAEKWPPPTTVRPPETPTETMEFLARSWSLSAA
EISKALRVLSGKGVSDDVHDAAAAVAGDRKERRSPVTMDGRRHEQASEENVAASMRADAS
SMAAAAQGGAMSPPISPRANLDVKLLRATATAAAAAGGRGGGGKTTMGTWIKEQKERKRA
EARSRNAQAYAATSVAGVSAAVAALFAGAVFSPPPDHPKNVGAAAPAPAPAHAAGAAGAK
TAAAIASAAALVASHCVEMAQAIGASHDQILGAIQSAVNAQTSGDIMALTAGAATALRGA
AMLRARLHKEIQAAALPGGGAGAGDISGREPERDTSPFAFVSRGGELLKRTRQGTITVII
KMRSAHMAGTFIKTKKFVVLDICSEIPAWAGREVEEGSHRRGYFGIKTVERMIEFECRSK
YEQHKWVQGITEMLNRRHTMKN
Download sequence
Identical sequences A2WMF2
OsIBCD000846 39946.BGIOSIBCE000982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]