SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001093 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001093
Domain Number 1 Region: 281-357,387-476,503-629
Classification Level Classification E-value
Superfamily Diaminopimelate epimerase-like 9.87e-53
Family PhzC/PhzF-like 0.0000311
Further Details:      
 
Domain Number 2 Region: 158-278
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.72e-25
Family Glutathione peroxidase-like 0.00012
Further Details:      
 
Domain Number 3 Region: 93-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000103
Family Glutathione peroxidase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001093
Sequence length 631
Comment 631
Sequence
MASSLLRKSTVVGSPTSPSAMVGFQGARVGGLRLRHRLGGARRVAAEGPLLGRGRRHQLL
HHPSQGHLPWEESGHLRPASNRVLHLIKQSSEGNMVGGCNSKNKKGAYTGVCSQAHVPSY
KNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAGKKVVIFGLPGAYTGVCSQAHV
PSYKNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEV
DLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPSDFKVSGAEVDAFAAEPFKGNPAAVCLL
EGEDAAAAADERWMQSVAAEFNLSETAFLIRDPSSSAAAADAAPRFRLRWFTPVAEVASP
FPPTLGFLLLVSPVFIRTRRRRCLQVNLCGHATLASAHFLFTTVLAKQQHAAAAMVEFVT
RSGILTAKKVPAPPPPANDGGVPGEEKLFIELDFPMIDLVEYDSAETLSIPETLNGARVI
KMEVMNHGNATATIISLRERIANLLRMLILNEELVELSSGKEVADIIPNINEIKKCDGRG
VIVTGPAPAGSDYDFFSRFFCPKFGIDEDPVCGSAHCVLAPYWGGKLGKQKLTAFQASPR
SGTLYLELDGENRRVRIQGEAVTVMAGTLLA
Download sequence
Identical sequences OsIBCD001093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]