SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001130 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001130
Domain Number 1 Region: 208-519
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.1e-85
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000604
Further Details:      
 
Domain Number 2 Region: 514-710
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 3.92e-47
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.0024
Further Details:      
 
Domain Number 3 Region: 52-159
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.25e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001130
Sequence length 715
Comment 715
Sequence
MEPKLAFPQDSPPLAILCAAKVAGVSLTLDPKLASGSAPTLHLGSGDFIHGVNTILRYIA
RVASVTSFYGQDAIQAAYVDQWLDYAPVILSGSEFEAACSFLDGYLASRTFLVSYGLSIA
DIVVWSNLAGTGQRWESLRRSKKYQNLVRWFNSIADYSDTLDEVVSAYVGKRGIGKSPAP
SLKEKLPDSKQNISIPEVDLPGAKVGEVCVRFAPEPSGYLHIGHAKAGLLNKYFAERYKG
RLIVRFDDTNPSKESNEFVENVLKDVETLGIKYDIVTYTSDYFPQLMEMAENLIKQGKAY
VDDTPKEQMRSERMDGVESKCRNNTVQDNLSLWKEMINGTERGMQCCVRGKLDMQDPNKS
LRDPVYYRCNTDPHHRIGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRIL
QEMGLRRVEIYEFSRLNMVYTVLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKVEA
LVQFILEQGASKNLNLMEWDKLWTINKKIIDPVCGRHTAVLKDQRVLFTLTNGPEEPFIR
VLPRHKKYEGAGKKATTFTNKIWLESADASVISIGEEVTLMDWGNAIIKEIKTQNGIITE
LLGELHLEGSVKMTKLKLTWLPDIEDLVSLSLVEFDYLIKKKKLEEDDNFLDNLNPCTCQ
EFPALGDANMRNLKQGEIIQLERKGYYRCDAPFIRSSKPIVLFAIPDGRQKSATK
Download sequence
Identical sequences A2WNB8 Q9LIZ8
OsIBCD001130 39946.BGIOSIBCE001291 39947.LOC_Os01g16520.1 LOC_Os01g16520.1|13101.m01847|protein XP_015651457.1.37577 LOC_Os01g16520.1|PACid:21910725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]