SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001352 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001352
Domain Number 1 Region: 516-700,743-789
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.57e-39
Family Phospholipase D 0.047
Further Details:      
 
Domain Number 2 Region: 925-1178
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.26e-29
Family Polyphosphate kinase C-terminal domain 0.083
Further Details:      
 
Domain Number 3 Region: 446-534
Classification Level Classification E-value
Superfamily PH domain-like 0.00000448
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001352
Sequence length 1308
Comment 1308
Sequence
MQGRYDVGGGVMSHKFMLDLNGEIEWQTYIDIVLGSHFKSLEVFAWKKYGRIGKKELIDP
NESPLIESPISCHELSERCSRKEELIDEDVEGGEGVNDMADVEVREENDPVREEVHVEEN
VPLREEVHAEDNVPLREEVNVEENVPVREEGDVEDGREVGDDVELPEEEANAKNVSMGLR
ELARLKFYTREECEEAMIRSGLNPGWLEYDTEDELDESASDSDDDRPVRKMSEHERTVFA
KLRGAVGCAGGRGGGGGGVRRGIREDAAEPEGEAAAAGAGSFLRLPESAGAFDELPRAMI
VGVSRGDAGDITPMLLSYTVEVQYKQFRWLLYKKASQVLYLHFALKRRAFLEEFHEKQEQ
VKEWLQNLGIGEHMPVVHDDDEADDVHVPSQHDEHSVKNRNVPSSAVLPVIRPALGRQQS
VSDRAKVAMQEYLNHFLGNMEIVNSREVWAVLKPGFLALLQDPFDPKLLDIVIFDVSPHM
DRNGEGQSTLAREIKEHNPLHFAFEVSSGGRTIKLRTRSSAKVKDWVSAINTARRPPEGW
SHPHRFGSFAPPRGLTEDGSVVQWFLDGQAAFNAIASSIEEAKSEIFITDWWLCPELYLR
RPFHHHESSRLDILLESRAKQGVQIYILLYKEVSLALKINSMYSKQRLLNIHENVKVLRY
PDHFSTGIYLWSHHEKIVIVDNQVCYIGGLDLCFGRYDTPEHKVVDVPPSIWPGKDYYNP
RESEPNSWEDTMKDELDRTKYPRMPWHDVQCALYGPACRDIARHFVQRWNYAKRNKAPNE
QAIPLLMPQHHMVIPHYMGKIKESNEEVSKQTHVEDIKGQKLSSLKAPASCQDIPLLLPH
EPDHQASNNGELGLNGLDNNHGHSDHPNKTHWKQPIPNRKAKQDTSLQDLQMKGFVDNLG
TPDVSSVIGHYDTSKQNVHHMDNEWWETQERGDQVDYVLDIGEVGPRATCCCQVVRSVGP
WSAGTTQIEGSIHNAYFSLIEKAEHFVYIENQFFISGLSGDDTIKNRVLEALYRRILRAE
KEKRCFRVIIVIPLLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILKNLYDVVGSKA
HDYISFYGLRAHGRLGDGGPLVTNQIYVHSKLMIIDDRMTLIGSANINDRSLLGSRDSEI
GMIIEDKEVVSSIMDGRHWEAGKFSLSLRLSLWAEHLGLHPGEVSQIMDPVDDLTYNNIW
MGTAKANTKIYQNVFSCVPNDHIHSRSQFRQGFAHRKEKIGHTTIDLGVAVEITETHKDG
DLAGTDPMEKLQAVRGHLVSFPLEFMCQEDLRPFFGESEYYTSPQVFH
Download sequence
Identical sequences OsIBCD001352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]