SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001587 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD001587
Domain Number - Region: 182-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0145
Family Glutathione peroxidase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001587
Sequence length 249
Comment 249
Sequence
MNSDELHQDAVTRGAGGEQRKALEKDCIPRAIGHLVELEWQALPIQSHHHHAIEDEIYAG
ELVEEELLFGCCRGVKYTEDKEENQDKEWHFLIFWLGRTMPLACSLRSSGVLHFIAYAMR
SIAARVHHRRPPLLVSLVQRPLNHELQCRLLPLCLSPLTSPPRVGFGTTFLKWLAFFAAV
MRVLLLSDSNGELAHTIGIELDLSDKPAGHDIRSRHYAFLAEHGVVKVLNLKEGVDFTSS
SIEEMLKAL
Download sequence
Identical sequences OsIBCD001587 39946.BGIOSIBCE001741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]