SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD001750 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001750
Domain Number 1 Region: 74-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.73e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001750
Sequence length 216
Comment 216
Sequence
MAPAKVYGPAMSTNVMRILVCLEEVGAEYEVVPVDMSTGEHKRPPHISRNPFGQVPAFED
GDLTLFESRAISKYILRKHGSDLLRESNLSESAMVDVWLEVESSHFDGAMSPIIFQCFIV
PMFMGGATDIGVVNESLEKLKKALEVYEAQLSKSKYLAGDFISLADISHFPTVYYLLASA
HASVLEAYPRVKAWIDDVMQRPSVKKVTEALKMPSA
Download sequence
Identical sequences A2WQ36 Q9AS47
OsIBCD001750 XP_015630378.1.37577 LOC_Os01g27390.1|13101.m02847|protein 39946.BGIOSIBCE001884 39947.LOC_Os01g27390.1 LOC_Os01g27390.1|PACid:21905126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]