SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD002355 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002355
Domain Number 1 Region: 39-312
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-107
Family BC ATP-binding domain-like 0.0000000083
Further Details:      
 
Domain Number 2 Region: 567-724
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-54
Family BC ATP-binding domain-like 0.00000849
Further Details:      
 
Domain Number 3 Region: 307-465
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.06e-52
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000564
Further Details:      
 
Domain Number 4 Region: 465-568
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-44
Family BC N-terminal domain-like 0.00000569
Further Details:      
 
Domain Number 5 Region: 726-863
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.75e-33
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0024
Further Details:      
 
Weak hits

Sequence:  OsIBCD002355
Domain Number - Region: 1-38
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.000216
Family BC N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002355
Sequence length 878
Comment 878
Sequence
MGGQTALNLAVSLADSGALDRLGVRLIGASLPAIRAAEDRQLFKQAMDRIGLKTPPSGIG
TTLEECISIAEDIGEFPLIVRPAFTLGGTGGGIAYNRAEFEDICRAGLAASHTQQVLVEK
SLLGWKEYELEVMRDMADNVVIICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYS
VAIIREIGVECGGSNVQFAVNPADGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSV
GYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSEPVLTTQMKSVGEAMALGR
TFQESFQKAVRSLETGFAGWGCAPIKELDWDWEKLKYSLRVPNPDRIHAIYAAFKKGMRI
QDIHEISFIDKWFLTELKELVDVEQFLISRGLDQLSKDDFYQVKRRGFSDTQIAFATSSS
ETDVRLRRLALEVAPTYKRVDTCAAEFEANTPYMYSSYEYECESVPTNKKKVLILGGGPN
RIGQGIEFDYCCCHASFALREAGYETIMMNSNPETVSTDYDTSDRLYFEPLTVEDVTNVI
DLERPDGIIVQFGGQTPLKLALPIQQYLEDKKLAGIHSGDSGCSLPTRTVSAKCLDIIRS
WTTKLAKRLNVCGLMNCQYAITTSGEVFLLEANPRASRTVPFVSKAIGHPLAKYASLVMS
GVTLPELGYTQEVVPKHVSVKEAVLPFEKFQGCDILLGPEMRSTGEVMGIDYEFSGAFAK
AQIAAGQKLPLNGTVFLSLNDLTKRHLAEIGRGFRELGFNIIATSGTAKVLQLEGIPVEP
VLKIHEGRPNARDMLKNGQIQVMVITSSGDALDSKDGLQLRRLALAYKVPIITTVDGARA
TIDAIKSLKNKSIETLALQDYFQTTDASQNLQAAQSAS
Download sequence
Identical sequences B8AAD1
OsIBCD002355 39946.BGIOSIBCE002410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]