SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD002980 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002980
Domain Number 1 Region: 84-230
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 13-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002980
Sequence length 239
Comment 239
Sequence
MAGRGGGGGGGELQLLGTWYSPYAMRAKIALGLKGLSYEYIEQDLFGKSELLLKSNPVHK
KVPVLIHAGRPVCESRVVLEYVDEAWPGAAPPLLPADPHGRAAARFWATYFDSTFFPPWR
ALMRATTAEQRAEAFMNAVPQVEVLERAFVECSKGKAFFGGDAVGLVDVVVGGFVVWFKV
VDEVAGSSLLDEAKFPGLAAWAERFLAVDAVREAMPDAGKLLEHYKGFLAKLASPAGST
Download sequence
Identical sequences A2WU01
OsIBCD002980 39946.BGIOSIBCE003244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]