SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD003677 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003677
Domain Number 1 Region: 264-347
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.4e-27
Family Vacuolar sorting protein domain 0.0091
Further Details:      
 
Domain Number 2 Region: 310-421
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-21
Family Vacuolar sorting protein domain 0.036
Further Details:      
 
Domain Number 3 Region: 7-137
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000676
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003677
Sequence length 473
Comment 473
Sequence
MSAAAADWLPAADVTAAGRPVLTAGEVERHLVAQGDVEPEESPRLGPLRARLLVLTSHRL
IFLHEPSRSARALPLAAVVHAYPPHRKHGHNPLRSIFSSSSSSSSSHHPRVRLQISLPPS
RSEVVAVVVSKGEADVFYGRLLEAVRARAWEVVAAVAAAPAGGSSAAQGAPAEEDLAITM
PVVGVSGILRMEQEAWESAGQNLQDAFQDLNALMSKAKEMMELAEKMRQKLLTNSSAQSN
SNDEEMGSKQDMQDWLLSVGIVSPVTKETAGALYHQQLSRQLADYIRTPLEKAGGMMALV
DVYCLYNRARGTELISPEDLLQACSLWEKFDVPVMLRKFDSGVKVIQTKTHSDDEVFARI
SSLAQKEDSLQKGISPSDAAFTLGIAPALAKEHLLNAESIGIRWDVSPDGLRFYINLFNE
IDPQNMYINLAPSGQSGLLVCGNPAMAYQCHNYQWAYAVRKPYTSSLPHRKHP
Download sequence
Identical sequences OsIBCD003677 39946.BGIOSIBCE004040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]