SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD003731 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003731
Domain Number 1 Region: 249-397
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-42
Family Myf domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 44-143
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-21
Family Arc1p N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003731
Sequence length 409
Comment 409
Sequence
MAAAAADFAASKRAMAYALCKNLSLDPNTISSTSIEESDIATLFSHIVKSSEDEVLKWVE
FSSNFVGKCGEQHVLLGNLNQDLSQKSVLLGNGFKPSVADIVVFATIQVFVSHLGENELQ
KYPHVLRWMDYIQNIVDFGTTVQKVNLTKSVFDPPSHPKKADKGDTDPSSKKVVSGQKNV
GKSDANVDSKKAAPENKAPENKANPTPAKNNKPSGDKKKAQEKSAGKPNEGVADKAPQKT
AEKDSECNVSILNIQVGLIRKAWKHPSADSLLVEEIDLGDGNVHQVVSGLAKFFSPEELV
NRHVVLITNVKPGKLRDVMSAGLVLCASNQDHTVVEPLIPPEGAKPGERISFAGFDGKPE
DVLNPKKKQLDKITPDLHTDGNGIATYRGVPLTTSAGPCRSSVPNASIK
Download sequence
Identical sequences A2WWG0
OsIBCD003731 39946.BGIOSIBCE004095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]