SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD003767 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD003767
Domain Number - Region: 3-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0453
Family Thioltransferase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003767
Sequence length 246
Comment 246
Sequence
MSVYYETLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQHGEEECQ
LNAIEACVIRLWPDAEQHFPFINCIEHLALTQKWNAWQSCFQETGLASQPVMDCYNSGYG
TQLQLQYAAETNALQPPHQFVPWVTVNGRPLGDDYTNFEAYICRAYDGELPEACRGKHLA
IAQQTRASRGGKIHKPDRCPCSCNAEESTKVGRSTCLLHRGVVLTSLERHFVEKTQTVQD
QMKLTK
Download sequence
Identical sequences A2WWK6
39946.BGIOSIBCE004139 OsIBCD003767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]