SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD003953 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003953
Domain Number 1 Region: 79-133
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000147
Family Cellulases catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003953
Sequence length 142
Comment 142
Sequence
MSFSPLSPLSHLFLSSHLQSLERGAAATAHREGGGGGCSRAVAATANGRADAASRRSGDE
APSGRSYGSSSSRRRDGSRHAHAHRDAFAAAAAYLDYIVDNADEFGGTRWAITKFSWDVK
YAGVQILAARISRDSNKHLALT
Download sequence
Identical sequences OsIBCD003953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]