SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004029 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004029
Domain Number 1 Region: 41-341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-85
Family Protein kinases, catalytic subunit 0.000000417
Further Details:      
 
Domain Number 2 Region: 311-331,378-497
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-25
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004029
Sequence length 498
Comment 498
Sequence
MAVGGDDDMERDFAARLRLAPSPASPTAAAGGGGGGIAFRAPQEQFTVGDFELGKIYGVG
SYSKVVRAKKKDTGNVYALKIMDKKFITKENKISYVKMERIVLDQLDHPGVIRLFFTFQD
TYSLYMALESCEGGELFDQIVRKGRLSEDEARFYAAEIVDILEYLHSLGLIHRDVKPENL
LLTSDGHIKIADFGSVKPTKDTPIKVLPNSTNERACTFVGTAAYVPPEVLNSAPPTFGND
LWALGCTLYQMLSGSSPFKDASEWLIFQRIIARDLKIPEYFSDDARDLIDKLLDVDPSKR
PGAGPDGYVSLKKHPFFRGIDWKNIRSTRAPKLAMEANANEDEDSQDSSWLSHMGSAPVN
QHVSPVGNDGASSSSEVRSHISRLASIDSFDSRWQDFLEPGESVVLISKLKKINKLTNKK
VQLILTDKPQLICVDPGKMVTKGNIMWSDDPSELNVQVSNSSHFRICTPKKVSSFEDAKQ
RAWQWKKAIEDLQRCQKN
Download sequence
Identical sequences A0A0D9YI27 A0A0E0FWD3 B8A703 I1NTT9
ONIVA01G43700.1 OGLUM01G43130.1 ORGLA01G0327900.1 OsIBCD004029 39946.BGIOSIBCE004441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]