SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004156 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004156
Domain Number 1 Region: 66-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.95e-30
Family Selenoprotein W-related 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004156
Sequence length 162
Comment 162
Sequence
MGRSVYVAAAVALVLTSCSVLCLGAERFGARECEELGFTGLALCSDCNALAEFVKEQELV
EDCRKCCTEDSDDSISKLTFSGAIIEVCMRKLVFYPEIVGFLEEDKDDFPYVEARYVYGS
PPKLIMLDDKGDQKETIRIDNWKREHIRQFLKEKVKPVKSDS
Download sequence
Identical sequences A0A0E0FWY8 A2WXV9
ONIVA01G45300.1 39946.BGIOSIBCE004581 OsIBCD004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]