SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004509 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004509
Domain Number 1 Region: 76-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.91e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.00054
Further Details:      
 
Domain Number 2 Region: 5-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.94e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004509
Sequence length 227
Comment 227
Sequence
MGERVKLIGAFASAYGHRAEVALRLKGVRYELILEDLRNKSDLLLNHNPVHKLVPVLLHG
DRSLSESLVILEYIDESFHGPPILPTDPYDRAVARFWAQFIDQKFGRFNFWIPFVQMEGN
MQDCFVREAKENLALLEGQLKGRRFFGGDAIGFLDIAACLIAHWLGAFEEVCGVTLATDE
EFPALCEWRRRYVNDEAVKPCLPNRDELVAYYRERKEMIKAAGRQHK
Download sequence
Identical sequences A2WZ32 Q8RZB3
LOC_Os01g72130.1|13101.m07858|protein 39946.BGIOSIBCE004989 39947.LOC_Os01g72130.1 XP_015640321.1.37577 OsIBCD004509 LOC_Os01g72130.1|PACid:21904141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]