SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004512 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004512
Domain Number 1 Region: 74-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.48e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004512
Sequence length 235
Comment 235
Sequence
MVKLISAFGSPFGHRAEAALRLKGVQYELLLEDLRSKSDLLLAHNPVHKLVPVLLHSDGR
SVAESLVVVQYVDDAFHGPPLLPADPYARAQARFWAQFIDDKLCVIELQFSRPFWLSFWM
EDGEKKEAFVREAKENLRPLEAQLDGGNKRFFGGDAIGLVDIAASGLAHWVGVFEEVTGV
SLVSEREFPALCRWSQRYVNDGAVRQCLPSRDELVALFTANKEAYTLLAKAKLQK
Download sequence
Identical sequences OsIBCD004512 39946.BGIOSIBCE004992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]