SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004703 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004703
Domain Number 1 Region: 70-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.73e-34
Family PDI-like 0.00054
Further Details:      
 
Domain Number 2 Region: 422-531
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-28
Family PDI-like 0.0003
Further Details:      
 
Domain Number 3 Region: 283-421
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.34e-20
Family PDI-like 0.038
Further Details:      
 
Domain Number 4 Region: 185-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000442
Family PDI-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004703
Sequence length 571
Comment 571
Sequence
MRSRSLLLVALATLLLHASASASDDDLDYLIDNADDIPANDPDGWLQEGSPDDDDDDDLF
HHGQAQDHPIDETHVFLLSAANFSDFLASHRHVMVEFYAPWCAHCQALAPDYAAAAADLS
PLAHQVALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPKDYNGARTKEAIVSWVNKKLA
PGVQNITTVDEAEKILTGEDKAILAVLDSLSGAHSDEIAAASRLEDAINFYQTSNPDVAK
LFHLDPAAKRPSLVLLKKQEEEKLTFYDGPFKASAIADFVSANKLPLVNTLTQETAPSIF
DNPIKKQACLIDIASILLFVVANESSKFLPIFKEASKSFKGKLLFVFVERDNEEVGEPVA
NYFGITGQETTVLAYTGNEDARNFFLDGEISVENIKRFAEDFLEEKLTPFYKSEPVPESN
EGDVKIVVGKNLDQIVLDESKDALLEIYAPWCGHCQELEPTYNKLGKHLRGIDSLVIAKM
DGTANEHPRAKPDGFPTILFYPAGKKSFEPITFEGDRTVVEMYKFIKKHASIPFKLKRPD
SSATKTEKDQSTASTNLRGERSSGTNFKDEL
Download sequence
Identical sequences 39946.BGIOSIBCE005218 OsIBCD004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]