SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD005133 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD005133
Domain Number 1 Region: 178-337
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.67e-55
Family Glutathione peroxidase-like 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD005133
Sequence length 339
Comment 339
Sequence
MRRAPRLHALLSRALAFGGLPPPPLPRAQLQGITEPGAASRLGAAFLARALATTGLPAPR
RPRALQRITEPGAASRFGAAFLARGGFSTDASAAAQDSAKPAAATGGEGGDGKSGKSEQG
DAGKSVRGGPVSWLSFLLLLVTGGGIIVYYDKEKKRHIEELKNRTSAVKQEPSVGTAAIG
GPFNLLNHDGKPVTQKDFFGKWTLLYFGFTHCPDICPDELQKMALAIDKIKEKAKMEVVP
VFITVDPERDTVEQVRDYVNEFHPSLIGLTGTTDEIRKVARAYRVYYMKTEEEGSDYLVD
HSIVMYLMNPKMEFVKFYGKNYDADSLADGIIKELKGHQ
Download sequence
Identical sequences A0A0E0NA62 A2X154
OsIBCD005133 39946.BGIOSIBCE005702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]