SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD005351 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD005351
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000144
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  OsIBCD005351
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily RNI-like 0.000162
Family Cyclin A/CDK2-associated p19, Skp2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD005351
Sequence length 292
Comment 292
Sequence
MDRTSAPPVRRNTYVSSSAAMNGGCPRGKRGRVRASPHATATAGLDFLSALPEGILHHIM
SFLNACQVIQTCVLSWRWHDLWRSVPRINANYGELSMSPIAAFTPDNEAAFKRFVNRLLE
RRDPAAVIHTFNLRYTISNPNNRDNDSADANRWISHALQNQASFLKIIVDAHELHLDHTV
FTSCYLGRITLKNVFLDQGFFEQLEIGCPLLQDLLLYDCIIGDDEISSETLNVLTMYGCQ
FPTLQESCISAPNLTSLIMHQPENFVPVLDDVASLFWKMLQLLLKTCTPTTT
Download sequence
Identical sequences B8AJ88
OsIBCD005351 39946.BGIOSIBCE005940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]