SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD005552 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD005552
Domain Number 1 Region: 254-414
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.16e-60
Family eEF1-gamma domain 0.0000564
Further Details:      
 
Domain Number 2 Region: 80-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.68e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 
Domain Number 3 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.14e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD005552
Sequence length 414
Comment 414
Sequence
MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP
DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA
PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKSFT
SEFPHVERYFWTMVNQPNFKKVLGDVKQAESVPPVQKKAPPPKEQKPKEAKKEAPKPKAV
EKPEEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYS
LWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGP
EIPKFVMDEVYDMELYEWTKVDISDEAQKERVSAMIEDLEPFEGESLLDAKCFK
Download sequence
Identical sequences B8AE83 Q0E2Q7
39946.BGIOSIBCE006170 OsIBCD005552 XP_015625858.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]