SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD005553 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD005553
Domain Number 1 Region: 319-479
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.7e-60
Family eEF1-gamma domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 141-274
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0039
Further Details:      
 
Domain Number 3 Region: 53-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000687
Family Glutathione S-transferase (GST), N-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD005553
Sequence length 479
Comment 479
Sequence
MPKARFDPTGSTGRGQSARRMPAYGVVGSALRRPICRKAYSSDGRDHPRATLGEIVLHTF
DGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDGPVFESN
VIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWLFPRLGF
APYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLADIVMTCNLYMGFARIMTKNF
TSEFPHVERYFWTMVNQPNFKKVMGDVKQADSVPQVQKKAAAPKEQKPKEAKKEAPKEAP
KPKAAEKPEEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYD
PEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLW
LFRGPEIPKFVMDEVYDMELYEWTKVDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK
Download sequence
Identical sequences B8AE84
OsIBCD005553 39946.BGIOSIBCE006171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]