SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006097 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD006097
Domain Number 1 Region: 176-322
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 23-73,122-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000786
Family Glutathione S-transferase (GST), N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006097
Sequence length 325
Comment 325
Sequence
MARSALDEVTDAGAFDRSPSTFRSSISRDSSARFPAVPGRYHLYVSYACPWASRCLAYLK
LKGLDHAIGFTSVKPIFERTRETDDHLGWVFPATGDEEPGADPDPFNGAKTIRELYEIAS
PNYIGKPTVPVLWDKQLKTVVNNESSEIIRMLNTEFNEIAKNPDLELYPAHLQTSVNEIN
ELVYDAINNGVYKCGFAKKQGPYDEAVTRLYEALDKCEEILSRQRYICGNQLTEADVRLF
VTLIRFDEVYAVHFKCNKRLLREYPNLFNYTKDIYQIPGISSTVNMEHIRKHYYGSHPSI
NPYGIIPAGPNIDYNTPHDRERFSA
Download sequence
Identical sequences OsIBCD006097 39946.BGIOSIBCE006717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]