SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006369 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD006369
Domain Number - Region: 952-1002,1071-1113
Classification Level Classification E-value
Superfamily PH domain-like 0.000656
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006369
Sequence length 1201
Comment 1201
Sequence
MLTMGRNRGGAVVAWMEVETAAAWIAVAPRLDEDQGGRGRSARGHQRPPQRALRHRLGHH
AHRRVIRMEPDLVGADAIHRIAGSGTPSLGHFVVLYLLRKYLGEYVEGLSVETLRISVWQ
GDVVLKDLKLKADALNSLRLPVTVKAGFVGTITLKVPWKSLGKEPVIVLIDRLFVLAHPA
PDGQTLKEEDREKLFEAKLQQIEAAEAATLEATSRSSKGGPVPGSNSWLYNLISTIIGNL
KVTISNVHIRYEDSVSNSGHPFASGFTLSRLAAVTVDEDGNETFDAGVALDKLRKSVELH
RLAIYHDSDSSAWKLAKKWEDLNPTEWGENDLPQIFQDGIDDHSGNSVWAMNRNYLVYPI
NGTLNYKRLGKQERGGPDIPLEKASLVLSDVSLTVTEAQYYDGIKLLETFSRFRTRVDVS
HLRPIVPVKVDCRAWWRYAVLAGWQQVKLAVGGPQIISSLTNPLPWSAHWHMEFALMVVD
TACEATHVCGVVHLKDSMELQQRTAQVVQGTRGERSCVGAIGSHGRELGISASFVDAMFN
YRENSGHKSHNTLEVRLLGHAKVETVKSKEILHKKGASKRRWWTFGWNSAELPSEENALL
EPQLDEEERLTKEEWQAINKLLSYQPEDDLSSPLEKVSPNTTRFLVDVSIGQAAARIINI
DRTEILCGRFEKLQVVTKLYPKSTRCDVTLRYCGLSSPEGSLAQSVVSEGKSNALDVSFV
RAPVGLDLDWQLVAKISPCHVTMKIEQVTRRAQEQLQMVLEEQSSFGLDIDLDAPKVRIP
LITCQPLLGNEHFVLDLGHFTLHTRDGTREEERRSLYSRFYIAGRDMAAFVVCDTAEDIY
SVPENQRVLSGPTVDANQFCSLLDRCGMSVIIDQIKVPHPSYPSTRVSFQVPNLDIHFSP
KRYGKIVELLGVLCKLKGSDSEDSDSCENCNLAPWYPADLAGDARTLVWKGLGYSLAEWH
TSYVVLSGMYLYILESEVSQDYQRCCSMASRQVIEVPSTSVGGSLYSIAVCSRGVDMQKM
INRSLHNPRKELADGDAFEKCTSDPGNYESSRPCANNGDEEAETTKSVKEDVLTMALEST
STLIIEFHNEIEKANWMKALVQATYQASAPPEVNILGDPVSTTEPSTPRLSSLGSVDLLV
NGSVVETKLSLYAKLDRKKKDPEEVVMLELLGSGGKFPRKWFYIVRCWDIRQLQSTLGLE
E
Download sequence
Identical sequences OsIBCD006369 39946.BGIOSIBCE006928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]