SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006594 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD006594
Domain Number 1 Region: 30-64
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000013
Family Tyrosine-dependent oxidoreductases 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006594
Sequence length 73
Comment 73
Sequence
MDLYLMFHSVLMHVAAALVVLVYIPLSMPVKLFLWAFVKPLRKESLRGKVVLITGASSGI
GEITYKPNASWMQ
Download sequence
Identical sequences A0A0D3F5J7 A2X5A5 A3A7A1
OsIBCD006594 39946.BGIOSIBCE007140 OBART02G17880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]