SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006688 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD006688
Domain Number 1 Region: 126-199,228-590
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.31e-46
Family CPF0428-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006688
Sequence length 624
Comment 624
Sequence
MGIAEVALHSMPGAFAAHSPASNLPLAADAARGRRRRSANSLHSSRALQGPVRFPGLRAA
VECQCQRIDDLARVTEGNGAWVKDAVDKASHALGDVRVPGQAVGGNGSVNGSAAKPPPQR
RKASSVEDEAWELLRESVVYYCGSPVGTIAANDPNDANPMNYDQVFIRDFIPSGIAFLLK
GEYEIVRNFILHTLQLQVFFFRHIIALSLEEVRTMSWEKTMDCHSPGQGLMPASFKVRTI
PLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTVQERIDVQTGI
KMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDG
SADLIRALNNRLIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWL
VEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAE
MPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMNRPEIAAKAV
EVAERRIAIDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILSNDED
AEILNALSTNRKRGKKVLKKTFIV
Download sequence
Identical sequences A2X5K4
39946.BGIOSIBCE007251 OsIBCD006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]