SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007159 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007159
Domain Number 1 Region: 22-105
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.38e-21
Family Tyrosine-dependent oxidoreductases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007159
Sequence length 107
Comment 107
Sequence
MRSRNVFARGGHARRAWWTGETVAVVTGANRGIGHALSARLPEQGLPVVLTARDGARGEA
SAAALRARGLRSVRFRRLDVSDPASVAAFASWLRDELGGLDILSVAA
Download sequence
Identical sequences 39946.BGIOSIBCE007759 OsIBCD007159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]