SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007238 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007238
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007238
Sequence length 133
Comment 133
Sequence
MGMAQSSSSSSRPSDSEQLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLA
ELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVP
LLTEAGAIATPSL
Download sequence
Identical sequences A0A0E0IKH4 A0A0E0NHU5 I1P291 Q6K953
LOC_Os02g40500.1|PACid:21920399 LOC_Os02g40500.1|13102.m04514|protein 39946.BGIOSIBCE007836 39947.LOC_Os02g40500.1 ORGLA02G0209700.1 XP_015626005.1.37577 ONIVA09G12430.1 OsIBCD007238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]