SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007255 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007255
Domain Number 1 Region: 27-294
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-63
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 295-439
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.11e-54
Family Succinyl-CoA synthetase domains 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007255
Sequence length 443
Comment 443
Sequence
MVRGSLGKLASRALSVAGKWQHQQLRRLNIHEYQGAELMGKYGINVPRGAAAGSVEEVKN
TLKNVFPSEKEENIAKVYSQCGFHTQNMTQLQIVVKSQILAGGRGLGTFKSGLQGGVHIV
KAEEAESLAAKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAITLDRNTAGPLII
ACSKGGTSIEDLAEKYPDMIIKVPIDVFKGITDDDAAKVVDGLAPKTADRQSSIEQIKKL
YELFCKSDCTLLEINPLAETADNKLVAADAKLNFDDNAAFRQKEIFAMRDTTQEDPREVA
AAKADLNYIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGSASEGQVVEAFKI
LTSDDRVKAILVNIFGGIMKCDVIASGIVNAAKQVDLKVPVVVRLEGTNVDQGKRILKES
GMTLITAEDLDDAAEKAVKASVK
Download sequence
Identical sequences OsIBCD007255 39946.BGIOSIBCE007859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]