SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007406 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007406
Domain Number 1 Region: 33-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.28e-28
Family Thioltransferase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007406
Sequence length 131
Comment 131
Sequence
MAAARAAVPIAVFLLLVLAEADPAAATRSPSAFVQNAIYSNRITIFSKTYCPYSMRAKRI
FRDLKENPYIVELDLREDGREIQSVLLDLVGRHTVPQVFVNGQHVGGSDDTANAHSNGQL
QKLLGNSQSQR
Download sequence
Identical sequences A0A0D9YVN1 A0A0E0GAF3 A0A0E0NIG2 A2X7T2 Q6H628
LOC_Os02g43180.1|13102.m04793|protein 39946.BGIOSIBCE008015 39947.LOC_Os02g43180.1 OGLUM02G26340.1 XP_015623237.1.37577 LOC_Os02g43180.1|PACid:21922558 OsIBCD007406 ONIVA02G28340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]