SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007459 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007459
Domain Number 1 Region: 285-403
Classification Level Classification E-value
Superfamily PH domain-like 0.0000132
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007459
Sequence length 421
Comment 421
Sequence
MRRRDHLLLMDAAPPPAAVAAAVQTLMEPMEFLSRSWSVSASDISRVLTGGVGARRSTNF
VVDRLSGMLMPETLALAAASSTNLSPRKRVRSSAIGWRVREVFLRDDLIRSSSFCVQYSR
CRSAISAHQHTIGRWFYHRDGSSSSSSSRVDKARAERARVHAAVTVASVAAAVAAVASGA
ANDPDDLDDAKMDAALASATQLLASHCIEIAELAGADHDQVASAVEAAVDVRSPGDLMTL
TASAATALRGATALRLRAQREARSKAAAVAPYEKTGSCRGDIWCKEGTLLKRSRKGALHR
KRVAVYINKKSQVIMKLKSKHIGGAFSKKKKSVVYGVDDDVQAWPAPHACGGGAVPPAPE
TASSEKCQFGLRTAQGVVEFQCESRAQKQDWVESVKNLLRQAAGGTAQLEHSFESLRLSA
S
Download sequence
Identical sequences A2X7Z5
39946.BGIOSIBCE008081 OsIBCD007459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]