SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007477 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007477
Domain Number 1 Region: 2052-2337
Classification Level Classification E-value
Superfamily BEACH domain 6.41e-108
Family BEACH domain 0.0000000532
Further Details:      
 
Domain Number 2 Region: 2457-2521,2565-2675,2719-2766
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-29
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 1931-2041
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-22
Family PreBEACH PH-like domain 0.002
Further Details:      
 
Weak hits

Sequence:  OsIBCD007477
Domain Number - Region: 357-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000343
Family Clostridium neurotoxins, the second last domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007477
Sequence length 2789
Comment 2789
Sequence
MGEEDAPEMPDASPRLPWEPGGVEHFDAALLGDAAYIVEEEEVSDVEMSEGSPVAPSESS
ALPSPPSLRKRLAPVVPSDVPEEVVRAVDAVIMGGGLERLREMVSGEDGELSHFVVDVLM
LTMGGVDGLDEGAGDGAVTLPSIMSSSRAAAIAAELLPYIPCGVEPSPRTRMARALLATL
SSCTRNRTMCTSSGLLAILLDAAEKLFVGMGQRSKWDGAPLVQCIQMLGGHSVSVKDLHS
WLLLIKKTLGTCWATSLTLALEKAVGCKEAKGPAVTFELGGEGSGLLAPAESRWPFSNGF
GFATWIYVESFSDSLNTGMATAAIAAAAASTSGKSSPSAAAAAASTLAGEGTKHMPRLFC
FLTMDNHGVEAYFHGQFLVVESGAGKGKKASLHFTYEFRPQCWYFVGLEYTSKQALLGKV
ESELRLYVDGELHESCPFELPRILKPLAFCCIGTNPPPTIAGLQQRRRQCPLFAEMGPIY
IFTESIGPERMSRIASRGGDALPSFSNGAGLPWKATNAHIRHIAEDNYTLDIEIGGSLHL
LYHPSLLNGRFCPDASPSGSTGTHRRPAEVLGMVHLSYRVRPAESLWALAYGGPMALLPL
TVSNVEMDNMEPILGDLSSSLATASLSVPIFRIISLATQHPGNKEELCRAHGPELLSQVL
HYLLETLSRLESGEKEILSDEELVAAIASLCQSQKNDHGLKVQLFSTLLLDLKMWSSCNY
VLQKKLLSSLADMVFAESACMHDANALQMLLDGCRRCYWVIHEADSIDTFTFTGTERPLE
KVNSLVDELLVVIELLLGAVSSTLASDDVRSLVGFVVDCPQPNQVARVLLLIYRLIVHPN
TSRANVFAQSFISRGGVEALLVLLQREAKSGDNNISDSCIVPQNSLWNAGSDPKSTSSDL
DLKTTAGEANCNGHKTQPLEHHEPPCHEGSTEPGFSSKWCLLKNQFLKNLGGIDFLNIAD
NVQNDIYNIDNGDGVLVGIVHVLGALVASGHLKFNLPAAKPKLPSSFLTTSNGEGNSMFE
DRVSLLLFAMQKAFQAAPRRLMTRNVYKALFSAVINVPSANGSLKLHDSGHRVKHTPLLS
VLLRSLPFASRAFQAHAIQDLLYLASTNNENRIALTSIAEWPEWILEVLISNHEDVEATI
HCAEWLSMVGGSSTGDQRIRREESLPIFKRRLLGNLLEFSAQELQVQQTEGINAAAAGVA
EEGMMPKETKIQADKATHLSLALAENAIVLLMLVEDHLRSRSQHYFLSCSIDSAASPASG
ASSAATRSNSLSRTGSEPLDAGGSRQSLSSDAGGLPVDVLASMADANGQISSEVMERVTA
AAAAEPYGSVRHAFVSYGTCISDLSEGWKYRSRLWYGVCIPPKSNIFGGGGSGWESWKSV
LEKDSNGSWIELPLVKKSIAMLQALLLDSQLGGGLGIGGGSGAGMDAMSALNQLLDSDQP
FFCILRLTLASIREDDNGEDDIFMRNISMKNVISEGLGCQTGSMMIHDDNSCSPSRKPQS
ALLWRVLGPILNMPVSESKRQRVLVASSIIYSEVWHAVSSDRKPLRKKYVGLIMPPFVAV
LKRYRSVLAGIHELTSSDGQNPLVVDDCALAADTLPIEVTIDSSQFVHNGYQLKLPGSCA
DAAAVSMISPGWAAAFASPPVAMALAMIAAGTSGTETIAPPTNKLRRRDTSLLERRSAKL
HTFSSFQKPIDATPNLPTSAPKDKAAAKAAALAAARDLERSAKIGSRRGLSAVAMATSGQ
RRAAGDIERAQRWNTSEAMCAAWLECLQSADSKSVSGRDFSALSYKYVALLVSSFALARN
LQRVEIFWKLDSTETSSRMRRFMKRNYKWSEHLSMANNYEENMLLCDGAESNYSHREDAD
SLFANALRTNSSIIVADAISVDGGHGNAKQTETETIYSSVDDSTSSDFSSVHNLVRSTVV
APCYSSSKNNERIIVELPSLMVRPFKVVRGTFQVTSKMINFIIDEHMSDSDSYMDDAAST
SGQYDQQDKDRSWFISSLHKIYSRRYLLRRSALELFMVDRSNFFFDFEDTEACKHAYRAI
VHTKPPYLNSIFLATQRPEKILKKSQLTERWARWEISNFEYLMELNTLAGRSYNDIAQAY
YHSKTLDLEDPSAYRDLSEPIGALNPARLKKFQEHYSSFNDPTIPKFHYSSHYSCPGTVL
YYLVRIEPFTALSIQQQGGRFGQDDHMFSCINKTWNSVLEDMNDVKELVPEMFYLPELFT
NVNSVDLGSTQLTGKLCSVQLPPWAENPVDFICKHRKALESDYVSAHLHEWIDLIFGHKQ
RGKDAVMANNVFPYATYEGMVDIDQITNPVQRRSMQDQICNFGQTPSQLLTIPHTKRRPL
ADILKLQTIFRNPTEVRSYVLPNPENCNVPASAMLVSDDSIVVVGANVPAAHLALHHWQP
NTSNGPGTPFLFHHGRNAINLSGGAIMRIFKGSAGSVDDYQFPRAIAFAASAIQNSSVVV
VTWGHADNSVKLISPDGARTIETAFGHLAPVTCVALSPDSNYLVTGSRDTTVILWRIRQI
GSLRKKSTPEPPPSTPTTPNDSASGDSSTSNSSKVLETSRRRRIEGPMHVLRGHLGEVTC
CSVSSALGLVASSSSTSGVLLHNLRTGRLIRKLDKQEAHLMCLSSEGIILIWNESEKRLS
TFTVNGIPIGTSVLTPFSGRVSCIEISVDGKFALIGTCLSNSCNRDGFSAIDDYELDKPN
GDDDLPELNETKPSVHVPSVCFIDLYKLEIIHMLKLGEGQNVTAIALQKDNTNLLVSTAD
KQLIVFTYPALSSKIGDRMLQEGNGVLES
Download sequence
Identical sequences 39946.BGIOSIBCE008106 OsIBCD007477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]