SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007907 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007907
Domain Number 1 Region: 57-329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-29
Family G proteins 0.00066
Further Details:      
 
Domain Number 2 Region: 588-709
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-18
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007907
Sequence length 928
Comment 928
Sequence
MDSLHLAQGPKLRPKMTEHSQAHPLPYPQSQRQHCSLQQKPDLNWSQPNPTWTNRTNGAG
KSPVLNSLIGHPVLPTGENGATRAPIVVDLQGDPGLSSKSIVLQIDSKSQQVSASALRHS
LQDRLSKGASGGSGKGRNDEIYLKLRTSTAPPIKLVDLPGIDQRVMDDSTISEYAGHNDA
ILIVVIPAMQAADVASSRALRLAKDIDPDGTRTIGVLSKIDQASADAKTVSCVQAILSNK
GAPRAAAEIEWVALIGQSVSIASAQAGSVGSENSLETAWQAEAETLKSILTGAPRSKLGR
IALVDTIAKQIRKRMKIRLPNLLSGLQGKSQIVQNELARLGEQMVSSAEGTRAVALELCR
EFEDKFLAHVTSGEGSGWKIVASFEGKFPDRIKQLPLDRHFDINNVKRIVLEADGYQPYL
ISPEKGLKSLIKGVLEMAKEPSRLCVEEVHRVLLDIVNASANATPGLGRYPPFKREVVEI
ATNALDVFKSDAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREDEVKNRSSKKAQDA
EQSNKGSGTGSEQSGGALKSLKEKFSQQDKDKDAKEGPNLQVAGPGGEITAGYLLKKSAK
NNEWSKRWFVLNEKSGKLGYTKKQEERHFRGVIVLEECNLEEIEEEELSKSLKDSKKANG
AEKGPSLVFKITNRVAYKTVLKSHSAVILKAETIADKVEWMKKIRGVIQSKGGSVKGLNT
PEGGSMRQSHSDGSLDTMARKPADPEEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQV
EKAKEDMLNQLYSKISAQTNAKIEELLQEDHNAKRRREKYQKQSSLLSKLTRQLSIHDNR
ASVASYTNDSSGAESSPRTSGQSGEDWRSAFDSASNGSVDRSSSHNETRSRSADSRGKRY
ENGDVNGGNSGSRRTPNRLPPAPPGQKY
Download sequence
Identical sequences 39946.BGIOSIBCE008590 OsIBCD007907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]