SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008379 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008379
Domain Number 1 Region: 216-350
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.23e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.008
Further Details:      
 
Domain Number 2 Region: 104-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000472
Family Glutathione S-transferase (GST), N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008379
Sequence length 404
Comment 404
Sequence
MPMWSQPPPPPSSLQLRRPPPPLPHHPRRLRSRLSPIAASQDPLTALSRLLWGRALPPSQ
LVLAVRHGWTAAWGLLMRQLAPSDPATGAFTRTPSRFPAVVGTPSARLHLYVGLPCPWAH
RALLVRALLGLERRLPLSVAVPGDDGAWSFTPDSPDALYGKRKLREVYASARRGGFEGRA
SVPLLWDAERREVVCNESIEIAKFLCDLAAADGSAGGLDLWPPELRQDIDRWYSFIYPSV
NNGVYRCGFAQSQEAYDDAAGELFAALDRLEDHLSGSRYLCGDTLTLADVCLFTTLVRFD
LVYHSLFRCTRRKLVEYASLHAYTRDIYQMPGVAGTCDMAAIADGYFGALFPLNPGGILP
LVPASCSPEALLEPHGREALSSSAAADAGGGGNGRQLEATSASN
Download sequence
Identical sequences A2XAY6
OsIBCD008379 39946.BGIOSIBCE009110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]