SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008472 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008472
Domain Number 1 Region: 103-191
Classification Level Classification E-value
Superfamily PH domain-like 0.0000344
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008472
Sequence length 819
Comment 819
Sequence
MALAFLLGFLLGLLALAALEAAALLWLVRRLRRRDSAPQPAPDADELPGERPFPYEKQGF
LWILEPEKTPKASNERSSIGGPKETKEKKNIVEVFPAKRSAKIKGRSLILSGPDGFHTTI
KLLNCTVFAVSASSMPSRKWAKRYPIKLESKEYQIYNGSKACYLYAETSWEKESWCKALR
LAATADKEKKNWHAKLSEEFNNYISSLNSEYPGFLKPTVFSSEDHEVMDRAIKTDGSSKV
RLFLKKLAKKASTKVPLEGKTSSGSSTQGERKILDKLRSYQGTPFIEGLMGSQDDKSNSS
SSQDTVKPSPTSPALGQIGQPSAFPDVNADDRIADEGTLCWNLLSSRLFFDAKMSDEIHK
AIKARIQRTLSSMRTPPYVGDITLADFSLGKLPPYVHAMRVLPLDLNELWAFEVDFEYSS
GILLHIETRLEVQEPELQKDIMKSNFGTDSNGEVESDLLESIEQYGNQFRDSQNSVSSVE
EKGEPDGSQPKSTGWTSAYISGWKNIMHSIADHVSQVPLSLAIKISSVRGVLRVHVKPPP
SDQLWYGFTSMPDLEWDIESSIGDRKITNSHIGSLIGNRFKASLRDSLVLPNCESISIPF
MLAEKDDWVPLKDAPFIWLNREPTETRSHAAAVTPTRPDEVILKDDASNKTVAPSLPNSS
ARSEETLKTAASIDEPTQVPVAAADASHEPRKSPLAPAGEASSPSSPDTIDELRKPLLIT
EKIQEEDSESKVESPSPLYTSLRGIVPAGEQSGDESKRKGGRRARMMDFGKKMGDKLEEK
RRHIEEKGRNIVEKMRENARTNSFDRSMTSSSHSNSQSQ
Download sequence
Identical sequences B8AF64
OsIBCD008472 39946.BGIOSIBCE009217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]