SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008626 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008626
Domain Number 1 Region: 132-252
Classification Level Classification E-value
Superfamily TPR-like 6.83e-17
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 211-340
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000109
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 346-461
Classification Level Classification E-value
Superfamily PH domain-like 0.0000387
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008626
Sequence length 484
Comment 484
Sequence
MEDSARPTPADSGELPNGAGMAEDAVVAPDAAEAPEEGEESGIANDSETNAALGAEAAPL
AAAHHAGAAWGAQGQRGALVGEIHAFGGQWDRICRQDSLQFSSHHDVAMDLINSVTGVDE
EGRSRQRILSFAAKRYVSAIERNPEDPDAYYNWALVLQESADNVDPDSSSSKDSLLEEAC
KKYAEATRLCPTLYDAYYNWAIAIADRAKMRGRTKEAEELWKQAIMNYDKAVQLNWNSPQ
ALNNWGLGLQELSAIVPARDKQTIIKTAISKFRSAIQLQFDFHRAIYNLGTVLYGLAEDT
MRSAGPDVSPNDLYSQSAIYVAAAHALKPNYSVYRSALRLVRSMLPLPYLKAGYLTAPPA
DNTIAPHKHWERSEFVLNHEGLQQVDASESPSSKPLGHMGRSKKYIKVAVEDIVSVSACS
DLTLPPGAGLCIETIHGPLFLVADTWESLDGWLDAIRLVYTIFARGKSDVLAAEPKAASR
QESL
Download sequence
Identical sequences 39946.BGIOSIBCE009380 OsIBCD008626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]