SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008774 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008774
Domain Number 1 Region: 84-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.18e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000325
Family Glutathione S-transferase (GST), N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008774
Sequence length 222
Comment 222
Sequence
MAAGLQVFGQPASTDVARVLTCLFEKDLEFELVRIDTFKREHKLPEFIKLRDPNGQVTFK
HGDKTIVDSRAICRYVCTQFPEGNKTLYGTGSLERASIEQWLQAEAQNFSPPSSALVFHL
AFAPHLNIPQDHAVIAENEKKLQQVLNVYDEILSKNEYLAGDEFTLADLSHLPNSHYIVS
SERGRKLFTGRKNVARWYDQISKRETWKQVVKMQREHPGAFE
Download sequence
Identical sequences A2XC68
39946.BGIOSIBCE009551 OsIBCD008774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]