SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008775 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008775
Domain Number 1 Region: 96-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008775
Sequence length 224
Comment 224
Sequence
MAAPVTVYGPMISPAVARVAACLLEKDVPFQVEPVDMSKGEHKSPSFLKLQPFGQVPAFK
DSLTTVFESRAICRYICDQYADSGNKTLMGRKEDGVVGRAAIEKWIEAEGQSFNPPSLAM
AFQLAFAPFMGRATDMAVVEQNEAKLVKVLDVYEQWLGENQYFAGDEFSLADLVHMPNTD
LLVRKTNKAGLFTERKNLARWWDEVSARPSWKKVVELQNVPRPS
Download sequence
Identical sequences A0A0E0GGE4 A2XC69
OsIBCD008775 ONIVA03G02390.1 39946.BGIOSIBCE009552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]