SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008994 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008994
Domain Number 1 Region: 72-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.58e-23
Family Thioltransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008994
Sequence length 232
Comment 232
Sequence
MASALTNCWAISRSSQRGSKNNSSDGSFMVPARNHNRINRKHLLLREKDASTGWQITKAA
TENSTNAVHTPMKTKWWEKNMKSCNMKNIESQEDFDKQLLLASDKLTVVHFFSPSCGACK
ALHPKVCQLAGMHPELQFLMVNSNEQKEMCRRLNVHVLPMFRFYRGAEGRICSFSCTIST
IYKIKDALKRHGVQLENLGPDKGLEKSELQNSDIDASYNMDGGVGAVVPNNE
Download sequence
Identical sequences A0A0E0NQ92 B8APA4
OsIBCD008994 39946.BGIOSIBCE009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]