SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009234 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009234
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-22
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009234
Sequence length 119
Comment 119
Sequence
MALRGVWQLQKLVVNYCDWGGSSRGIRAFMEAHLPAFKEKNPHLEVVTELVRGQHPNLKG
IYKNHNERVVCVRNLAPEDILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM
Download sequence
Identical sequences A0A0D3FF83 A0A0D9Z3P5 A0A0E0KAB0 A0A0E0NRA2 A2XDR4 I1P8Q4 Q8H065
39946.BGIOSIBCE010084 39947.LOC_Os03g10930.2 LOC_Os03g10930.1|13103.m01232|protein LOC_Os03g10930.2|13103.m01231|protein OPUNC03G07470.1 XP_015627761.1.37577 OsIBCD009234 OBART03G07680.1 OBART03G07680.2 OGLUM03G07840.1 LOC_Os03g10930.1|PACid:21915848 LOC_Os03g10930.2|PACid:21915849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]