SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009247 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009247
Domain Number 1 Region: 208-410
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-28
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  OsIBCD009247
Domain Number - Region: 588-659
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009247
Sequence length 899
Comment 899
Sequence
MSASEFRIPYQQVSSSQTAENAGQYKICRCGEGDPNTSETGDSSPTSCPNCQVLKSGHLL
LSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPVRGNEPVVTLGGIDLNNTGSVVVKEDR
KLLTVLFPDSRDGRTFTLKAETTEELNEWKSALENALAQAPAVANAVGQNPIFSTDIAEP
AEAPAEQPDDKSVIGRPAEFALVDADGSPSFLEKALKFIEDYGVKVEGILRQSADVEEVK
RRVQDYEKGKNEFSPEEDAHVIGDCIKYVLREMPSSPVPAPCCTALNYKRIKMFDCTGTD
KTKRLDAMSKVIYEVFPEPNQQLLQRILKMMQIVGSHKAVNRMSPSALAACMAPLLLRPL
LLGECEIDSDFSMAGDGSFQLLQAAAAANHAQAIVIIMLEEYDEIFDDLEDGSCSSDAYT
DSEDGDVDKEYSTDNDVDGSYDSGEDNIEEDMEDDTEYSSGGSECDDKVKRNNSGKASNG
NDKGFQPPKKAARTEHGVLREDTNQISSVPPVENTSQMESNDPSHRKLHESNGSTDQIEK
SNVRASSSRAKFMEKSSSRNKSKKTLLGRASARRDLSADETDFCSDDETLIEKLENNKTD
LQSKITKEVKENSILQASLGRRKEELHERRLALEKEVENLRDQLQKERKLRASLESGLMN
LRRGQVSFPSTIDSKTKADLEEVATAEADILNLKQKVSDLRGQLNNNVQMSSTSLCDSCN
KRLLSTDKLFEDEQNTSPSNVGPNSMSDMASATDMADIEQSRKQTTQHSSSSIDKPTLHK
HQKSIASNEQSSTISQRAQRILSSKGGIMKDGQDGSFTSKWNLAQKQYSNNPLLGRLGSN
AYSSTRTEESGAVPFALAKLTNRLNFLKERRAILASEMQNLNLARPPGPTAPAPKKDST
Download sequence
Identical sequences B8AQI0 B9F646
OsIBCD009247 39946.BGIOSIBCE010100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]