SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009704 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009704
Domain Number 1 Region: 103-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.41e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009704
Sequence length 223
Comment 223
Sequence
MAPAITARSSFASAVTADASSFLLVLPFNARLTPVLSFTRARCDRCSGFTYKKCSFLQVV
YGNRNGNGSSSSSKLAMEVLPPTMPSASKQPPLYDGETSCSGRLYMSYICPYAQRAWIAR
NYKGLQEKIKLVPMDTNDRPAWYKEVYPKNTLPSLEHNNKIIGESLDLIKYIDINFAGPR
LTPDDSEKQRLAEELLAYSDIFNQAVRSALISKDAMTAEAGKN
Download sequence
Identical sequences OsIBCD009704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]