SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009706 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009706
Domain Number 1 Region: 86-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.41e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0075
Further Details:      
 
Weak hits

Sequence:  OsIBCD009706
Domain Number - Region: 181-241
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00703
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009706
Sequence length 302
Comment 302
Sequence
MAPAITARSSFASAVTADASSFLLVLPFNARLTPVLSFTRARCDRCSGFTYKKCSFLQVV
YGNRNGNGSSSSSKLAMEVLPPTMPSASKQPPLYDGETRLYMSYICPYAQRAWIARNYKG
LQEKIKLVPMDTNDRPAWYKEVYPKNTLPSLEHNNKIIGESLDLIKYIDINFAGPRLTPD
VDIAYAPFIDGFQTLFAGIKNYDITEGRANIQIFIKELNKIDAYMHTKQDPSEVIALTKK
KLGGRIHRWGLSLSSISAEPPALHAEQQPHGFGREAAYCISADQPGRKEGANKDNISRSM
GD
Download sequence
Identical sequences A2XFA8
OsIBCD009706 39946.BGIOSIBCE010632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]